Recombinant Human Cholecystokinin (CCK), partial

Code CSB-YP004771HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004771HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004771HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP004771HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
CCK
Uniprot No.
Alternative Names
(1-49)-CCK58; CCK; CCK12; CCK18; CCK25; CCK33; CCK39; CCK5; CCK58; CCK7; CCK8; CCKN_HUMAN; Cholecystokinin-5
Species
Homo sapiens (Human)
Expression Region
46-103aa
Target Protein Sequence
VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Gene References into Functions
  1. We found the suicide-associated gene coexpression network. The reconstructed network consisted of 104 genes. Topological analysis showed that in total, CCK, INPP1, DDC, and NPY genes are the most fundamental hubs in the network PMID: 29381655
  2. L-trp is a luminal regulator of CCK release with effects on gastric emptying, an effect that could be mediated by CCK. L-trp's effect on GLP-1 secretion is only minor. At the doses given, the two amino acids did not affect subjective appetite feelings. PMID: 27875537
  3. The CCK polymorphism have reported significant association of -45C>T polymorphism with the presence of hallucinations. PMID: 27084212
  4. CCK does not appear to play a unique independent role in satiety/satiation. PMID: 26429068
  5. CCK release has been found to be halved in pregnant women with hyperemesis gravidarium, which supports the hypothesis that gastrointestinal motility is increased in pregnant women with hyperemesis gravidarium. PMID: 25331205
  6. CCK in plasma is an independent marker of cardiovascular mortality in elderly female patients. PMID: 26878472
  7. These data offer preliminary evidence supporting an association between the rs1799923 polymorphism in the CCK gene and PTSD PMID: 26454231
  8. Data suggest that endocrine responses differ between jejunal and gastric enteral feeding, with higher peak plasma CCK (cholecystokinin), PYY (peptide YY), and GLP-1/2 (glucagon-like peptides 1/2) concentrations being attained after jejunal feeding. PMID: 26762368
  9. active GLP-1 produced in the islet stimulates cholecystokinin production and secretion in a paracrine manner via cyclic AMP and CREB. PMID: 25984632
  10. Cardiac expression of pro-cholecystokinin is cell-specific, which differentiates the expression from that of intestinal endocrine cells and cerebral neurons. Plasma Pro-CCK is a prognostic marker in patients with stable heart failure. PMID: 25627687
  11. CCK binding modulates the contractile function of the lower esophageal sphincter through differential binding to the CCK-A receptor on the sling and clasp fibers PMID: 24914377
  12. Data suggest that up-regulation of plasma CCK levels is 50% higher following breakfast of meal replacement beverage containing fat emulsion of rapeseed oil with droplet size of 0.1 um (versus 0.3 um); satiety response and food intake are unaffected. PMID: 23975326
  13. These studies identify a key role for Cck in the development and treatment of mania. PMID: 23399917
  14. Results suggest excessive local release of CCK in response to duodenal lipid in functional dyspepsia. PMID: 24252886
  15. CCK enhances cholesterol absorption by activation of a pathway involving CCK1R/CCK2R, Gbetagamma, PI3K, Akt, Rab11a, and NPC1L. PMID: 24692543
  16. This review will summarize what is known regarding CCK, its receptors, and pancreatic--{REVIEW} PMID: 24177032
  17. We aimed to determine whether fasting or meal-stimulated ghrelin, PYY, CCK, and satiety responses are different between lean PCOS patients and healthy women. PMID: 24001751
  18. hnRNP-K regulates extracellular matrix, cell motility, and angiogenesis pathways. Involvement of the selected genes (Cck, Mmp-3, Ptgs2, and Ctgf) and pathways was validated by gene-specific expression analysis PMID: 23564449
  19. Normal CCK profiles in AN at admission indicates hormonal responses adapted to low food intake while change of eating habits and weight gain PMID: 23349895
  20. CD36 is a major mediator of FA-induced release of CCK and secretin. These peptides contribute to the role of CD36 in fat absorption and to its pleiotropic metabolic effects. PMID: 23233532
  21. a lineage of mature enteroendocrine cells have the ability to coexpress members of a group of functionally related peptides: CCK, secretin, GIP, GLP-1, PYY, and neurotensin PMID: 23064014
  22. CCK remarkably increases the firing frequency of action potentials of layer III pyramidal neurons in the entorhinal cortex. PMID: 21753024
  23. CCK gene -45C/T locus T allele was positively associated with schizophrenia in female Han population in northern China. PMID: 21542221
  24. it is likely that unsulfated CCK peptides constitute a separate hormone system that acts via CCK-B receptors. [review] PMID: 21985915
  25. This article reviews the role of cholecystokinin (CCK), a satiety-producing hormone, in the regulation of binge eating in those who suffer from bulimia nervosa [review] PMID: 22188045
  26. The results of this study demonistrated that the cholecystokinin polymorphisms is related toin Parkinson's disease hallucinations in asian group. PMID: 21506165
  27. CCK modulates intrinsic neuronal excitability and synaptic transmission in a surprisingly cell-type specific manner, acting as a key molecular switch to regulate the functional output of neuronal circuits. PMID: 21154912
  28. Cholecystokinin gene polymorphisms are not associated with antipsychotic induced weight gain in schizophrenia patients. PMID: 20732371
  29. Neither treatment of pancreatic cancer cells with CCK antibodies nor the down-regulation of CCK mRNA and peptide by shRNAs altered growth in vitro or in vivo. PMID: 21186400
  30. These results point to a potential route of action by which components of Hoodia might influence appetite control; the natural taste receptor antagonist was identified for further studies as an appetite suppressant. PMID: 20930049
  31. Study compared CCK-like immunoreactivity (CCK-LI) in plasma from 25 subjects in the late luteal phase (LLP) and the follicular phase (FP) and found that there was no difference during the menstrual cycle PMID: 20457200
  32. results suggest that the CCK system may play a role in the pathogenesis of panic disorder, with susceptibility alleles both protecting and contributing to the disease PMID: 20023595
  33. REVIEW: role in thermoregulation and other aspects of energetics PMID: 20036221
  34. Cefaclor, when given before a meal in the form of a capsule, does not stimulate CCK release or slow gastric emptying in healthy humans. PMID: 19914303
  35. This article reviews the corpus of work supporting the role of CCK in anxiety and suggests three research approaches which can further enhance our understanding of the CCK-2 system in panic disorder. PMID: 11713976
  36. This review describes the signaling pathways and transcription factors involved in neuronal CCK gene transcription. PMID: 11713982
  37. Endoproteolytic processing events of heterologously expressed cholecystokinin are studied in Saccharomyces cerevisiae. PMID: 11713985
  38. mapping of the CCK1R binding site by identifying residues that interact with the methionine and phenylalanine residues of the C-terminal moiety of CCK PMID: 11724786
  39. Deteriorating gallbladder contractions, possibly induced by alterations in the CCK-AR gene, as well as CCK-AR gene polymorphism, promoted gallstone formation. PMID: 12572876
  40. Results suggest that the L-(-188G) haplotype may act as a protective factor against panic by reducing the expression of anxiogenic cholecystokinin (CCK). PMID: 12627463
  41. in Chinese, visual hallucinations in Parkinson's disease are associated with cholecystokinin -45C>T polymorphism, and this association was still observed in the presence of the cholecystokinin-A receptor TC/CC genotype PMID: 12777967
  42. reduced basal hunger, rather than increased meal-induced satiety, contributes to the anorexia of aging and that changes in cholecystokinin are unlikely to be responsible PMID: 12915664
  43. CCK's suppression of food intake is enhanced when the stomach is distended. PMID: 12920059
  44. Ingestion of a CCK-releasing fatty acid reduces the tolerated volume of liquid delivered into the stomach, primarily via a CCK(1) receptor-mediated delay in gastric emptying. PMID: 14764444
  45. Review summarizes the physiological role of CCK not only in the stimulation of pancreatic and biliary secretions but also in the regulation of gastrointestinal motility. PMID: 15100163
  46. Study based on a small, well-characterized matched case-control group of patients with Parkinson disease (PD) suggests that the cholecystokinin system may influence the development of hallucinations in PD subjects. PMID: 15313848
  47. Ewing sarcomas synthesize and secrete proCCK that can be identified in plasma as circulating tumor marker. PMID: 15328192
  48. CCK regulates pancreatic enzyme secretion and growth, intestinal motility, satiety signalling and the inhibition of gastric acid secretion--REVIEW PMID: 15533776
  49. conclude that women with polycystic ovary syndrome (PCOS) have reduced postprandial cholecystokinin(CCK) secretion and deranged appetite regulation associated with increased levels of testosterone PMID: 15624269
  50. Gastrin and CCK exert a trophic action on some of the biliary tract cancers. PMID: 15682471

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Gastrin/cholecystokinin family
Database Links

HGNC: 1569

OMIM: 118440

KEGG: hsa:885

STRING: 9606.ENSP00000335657

UniGene: Hs.458426

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1